SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|220932593|ref|YP_002509501.1| from Halothermothrix orenii H 168

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220932593|ref|YP_002509501.1|
Domain Number 1 Region: 141-279
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.64e-43
Family UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase LpxC 0.00012
Further Details:      
 
Domain Number 2 Region: 7-132
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.82e-35
Family UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase LpxC 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|220932593|ref|YP_002509501.1|
Sequence length 288
Comment UDP-3-O-(3-hydroxymyristoyl) N-acetylglucosamine deacetylase [Halothermothrix orenii H 168]
Sequence
MFIDGNLQQTIEKPVKASGTALHTGKEVNVRFLPAGEDTGVVFKRVDLPDNPEIKAEPWQ
VVSTRRCTSIGLSKDSDSPKVHTIEHLMAALWALEIDNVIVEIDAPETPVMDGSALPYLK
LLKKAGIRELSSPRKIWVIDEPVWVKRGHMYMVILPYDGFKISYTLDYDHKVIGTQFFEF
DKGENSFEEEIAPARTFGFEREVEALHRRGLALGGSLENAVLIGDEDTVNPLRFSNEFVR
HKILDVIGDMALNGFVSGHIITVRSGHSLHVELAQEINKKLIQESERV
Download sequence
Identical sequences B8CYY7
373903.Hore_17570 WP_015923476.1.20074 gi|220932593|ref|YP_002509501.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]