SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|220932898|ref|YP_002509806.1| from Halothermothrix orenii H 168

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220932898|ref|YP_002509806.1|
Domain Number 1 Region: 3-202
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.49e-61
Family GHMP Kinase, N-terminal domain 0.0000148
Further Details:      
 
Domain Number 2 Region: 206-387
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 8e-52
Family Galactokinase 0.0000969
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|220932898|ref|YP_002509806.1|
Sequence length 404
Comment galactokinase [Halothermothrix orenii H 168]
Sequence
MKSVDELWEFFENRYGDNGLKKGSYSAPGRVNLIGEHTDYNDGFVLPMAIEKNVTMLGQL
RHDRKIKVYSLDYDTELCFNLDKLEKDEEHTWVNYVMGVADEIEKKGHKLKGMNLVFTGN
VPQGSGLSSSAALEVVTAMTMADLNELDIDPVEMALLCQAAENNFVGVACGIMDQYISRL
GHRDHALLIDCRTNEYELIPFKDKRYRIVICNSKARRGLVDSEYNTRRSECNQAVAFFNE
KLGRNITALRDVKLNEVGQYRGELSDSVYRRAHHVVSENERVLASVEALKNNDFEKFGQL
MIESHQSLRDDYEVSCRELDCLVDVALKQEGVLGARMTGAGFGGCTVNLVDINYVEVFIK
GIKEGYKRETGIEPEIYVSRPAEGARRLEVDRDGGNPGKEGKNR
Download sequence
Identical sequences B8CZV9
373903.Hore_20660 gi|220932898|ref|YP_002509806.1| WP_015923780.1.20074

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]