SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|220932968|ref|YP_002509876.1| from Halothermothrix orenii H 168

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220932968|ref|YP_002509876.1|
Domain Number 1 Region: 4-157
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.87e-44
Family GHMP Kinase, N-terminal domain 0.0000355
Further Details:      
 
Domain Number 2 Region: 163-271
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 2.93e-18
Family 4-(cytidine 5'-diphospho)-2C-methyl-D-erythritol kinase IspE 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|220932968|ref|YP_002509876.1|
Sequence length 287
Comment 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [Halothermothrix orenii H 168]
Sequence
MEEVVIKAPAKINLCLDIKGLREDGYHEVDMIMQSIALYDRLHLQKSGDGIKISTNSDRV
PTGRENLAYKAAELILDEAGLHNGVNIHIEKNIPVAAGLAGGSTDAAAVLKGINQLYGLN
FSYNRLVSMARKLGSDVPFCLQGGTARATGRGDYLTQLDDLQKTYLVVVTPPVALSTAYI
YSQYDKNPFSGSIPVTRFVNLISNNKKITWEEGWYNVLEPVSIKETFDIKEIKSLLEDRG
VRLSLMSGSGPSVFAIVDSWDKGCEIKESWPRRGDFVHPTWTLKKEF
Download sequence
Identical sequences B8D0E5
gi|220932968|ref|YP_002509876.1| 373903.Hore_21360 WP_015923850.1.20074

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]