SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|220933192|ref|YP_002510100.1| from Halothermothrix orenii H 168

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220933192|ref|YP_002510100.1|
Domain Number 1 Region: 14-114
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.79e-28
Family RNase P protein 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|220933192|ref|YP_002510100.1|
Sequence length 121
Comment ribonuclease P protein component [Halothermothrix orenii H 168]
Sequence
MEGVEQGGKCVDSLKNSDFKRVYSKGKSLASRYLVLYYYPNNLDKNRIGFSISKRVGKAV
VRNKLRRRLKEIIRLTDNIKSGYDLVFIGRKPSVSLDYHDLKKDVHQLLKRARLLGRRCL
L
Download sequence
Identical sequences B8D1F3
gi|220933192|ref|YP_002510100.1| 373903.Hore_23600 WP_015924073.1.20074

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]