SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|241518293|ref|YP_002978921.1| from Rhizobium leguminosarum bv. trifolii WSM1325

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|241518293|ref|YP_002978921.1|
Domain Number 1 Region: 60-157
Classification Level Classification E-value
Superfamily Bactericidal permeability-increasing protein, BPI 0.0000366
Family Bactericidal permeability-increasing protein, BPI 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|241518293|ref|YP_002978921.1|
Sequence length 159
Comment hypothetical protein Rleg_5554 [Rhizobium leguminosarum bv. trifolii WSM1325]
Sequence
MRNCLGLLTAGVFLLQPCSFAKAQAPNALERAIGDVQPCRSLKTKVSSFGISVEVGVDKL
DSVKIENLQLSVNGDTAEASARGTLACKTSDEALVEGGFSATAEVRLKIDLSTCKTTDTS
IEIVKTGGRFGDVVKGLETQISGVLRQSLEKNLAKLCQK
Download sequence
Identical sequences C6B8Y2
WP_012760308.1.14669 395491.Rleg_5554 gi|241518293|ref|YP_002978921.1| gi|241518293|ref|YP_002978921.1|NC_012853

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]