SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|241667001|ref|YP_002985085.1| from Rhizobium leguminosarum bv. trifolii WSM1325

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|241667001|ref|YP_002985085.1|
Domain Number 1 Region: 26-73
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0000445
Family Tudor domain 0.058
Further Details:      
 
Weak hits

Sequence:  gi|241667001|ref|YP_002985085.1|
Domain Number - Region: 72-113
Classification Level Classification E-value
Superfamily Chromo domain-like 0.00989
Family Chromo barrel domain 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|241667001|ref|YP_002985085.1|
Sequence length 124
Comment hypothetical protein Rleg_7114 [Rhizobium leguminosarum bv. trifolii WSM1325]
Sequence
MKSFVAAAIAIGVMCSCASVASAQTKGDWVLGNYKGAGYWFPGVIDSASGGKVTIRYDDG
DKETVSLSDVRPYDWVIGMKVECNYKGAGDWYAGKITSLGGEKIGIAYDDGDKETTRTGR
CRSR
Download sequence
Identical sequences C6B7R5
gi|241667001|ref|YP_002985085.1| WP_003553546.1.14669 395491.Rleg_7114 gi|241667001|ref|YP_002985085.1|NC_012858

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]