SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|222152340|ref|YP_002561515.1| from Streptococcus uberis 0140J

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|222152340|ref|YP_002561515.1|
Domain Number 1 Region: 153-266
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000105
Family Myosin rod fragments 0.0032
Further Details:      
 
Domain Number 2 Region: 341-411
Classification Level Classification E-value
Superfamily G protein-binding domain 0.00000628
Family Rabaptin-5 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|222152340|ref|YP_002561515.1|
Sequence length 515
Comment lactoferrin binding protein [Streptococcus uberis 0140J]
Sequence
MRKFYYKEKKMEIKQKHGKHALRKAVTAAVLAGTAFSSLGGFAGAVTTVKAEDLFTINNS
EVQDKLESKVKQLLEAQRKGEDISEKLRELLSELPTDILKDIMLSNIEADYLLGFLKPAV
EEMVRRSEQNDERWKDITEKTLALEALKDSEREIRKEKEKLEDEVQLAKVKIETKESELN
DLKKDYIDTREELADTIEELDEVKNSIVEKEAKVKGLEEKLRDLEKELGDYDKKLSEAAK
QNSDLSNENKELKENLDTAENITVELQKKSHELEKTKKEVELELKAEKEALEAEKVKLAE
ANEANDKLSEERDAAKKEAEKVPELEGQVEKLVEEITAAKKEAEELQAKAEGLEKDFEAV
KAEKEALEAEIAKLKEDHQKEVDALNALLADKEKMLKSLQEQLDKAKEEAMKNEQMSQEE
KAKLQAELDKAKQELAEKIKDMPNKVAPQAEGKANAGQAAPNQNQNNQAQANQAKNANNL
PSTGDKPVNPLLVASGLSLMIGAGAFVYAGKRKKG
Download sequence
Identical sequences B9DT25
218495.SUB0145 gi|222152340|ref|YP_002561515.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]