SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|225849865|ref|YP_002730099.1| from Persephonella marina EX-H1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|225849865|ref|YP_002730099.1|
Domain Number 1 Region: 123-547
Classification Level Classification E-value
Superfamily C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 9.02e-107
Family C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.0000000008
Further Details:      
 
Domain Number 2 Region: 16-124
Classification Level Classification E-value
Superfamily Cytochrome c 8.89e-21
Family N-terminal (heme c) domain of cytochrome cd1-nitrite reductase 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|225849865|ref|YP_002730099.1|
Sequence length 547
Comment nitrite reductase (cytochrome cd1) (cytochromeoxidase) (Hydroxylamine reductase) [Persephonella marina EX-H1]
Sequence
MKVSRSLTTFLSAATVASFLTVAVTAANAGPPPLTKEEMKKASQIFFDRCAGCHGMLRKG
ATGPALTPEALKKKGYNTEVLEAFIYNGTPGGMPDWGKQGVLSKSEINLLARFLQHEPPS
PPEMSLADMKRSWKVFIPPEKRPKRPQHNLNWKNFFGVILRDVGKVAIVDGDTKKLVNIV
DTGFAVHILRSSASGRYMYSIGRDGKATVIDLWLKKPDKVAEVKTCYDARSIDTSKYHGY
EDKYAVIGCYWPPSFVVVDGETLEPKKIVSTSSYYYDTQEFVREARVASIVSSHYDPIWV
LNIKEAGQVWLVDYSKVDKGTVKIDMIDAERYLHDGGWDLSKRYFLVAANMRNTIVVIDT
KDKELEALIKVGTKPHPGRGANIDHPKYGPIWCTGHIGEKRVACIGTDPEGHPEYAWKVV
KWFNLPGEGGGNLFIKTHPNSKYLLADRPLNPDPELKRSIFVFDKVTFKLVKTLKIPSKY
KNVRAVHEEFNEDGSEFWISVWGKKDYPTAILVYDAKTLKLKKEITGDWVRTPTGKFNVT
NTMKDIY
Download sequence
Identical sequences C0QTT4
gi|225849865|ref|YP_002730099.1| WP_012676432.1.53201 123214.PERMA_0306

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]