SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|225849866|ref|YP_002730100.1| from Persephonella marina EX-H1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|225849866|ref|YP_002730100.1|
Domain Number 1 Region: 126-466
Classification Level Classification E-value
Superfamily C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 4.97e-58
Family C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.00031
Further Details:      
 
Domain Number 2 Region: 3-102
Classification Level Classification E-value
Superfamily Cytochrome c 3.15e-21
Family N-terminal (heme c) domain of cytochrome cd1-nitrite reductase 0.089
Further Details:      
 
Domain Number 3 Region: 473-553
Classification Level Classification E-value
Superfamily Cytochrome c 0.000000000175
Family monodomain cytochrome c 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|225849866|ref|YP_002730100.1|
Sequence length 556
Comment cytochrome c, class I [Persephonella marina EX-H1]
Sequence
MRRWLLLLLFGLSVVATSYPQEVGEGQLLYQTHCASCHGEDRAGKVAPPLFSLFLKRYSE
KKLFNIIKNGLPASQMPAFSHLSEKEIKQIITYIKKPANISWDIDKIKKSITLNSDKKGK
DLKIRDIKNIVAVVERGKNKVWIMEGLQILDKFDFKNVHGGLKFSPSGWSVYVPSRDGWI
GRYDIDKGRFYGKVRACVYLRNISLDRTGKYILVSCWLPEGIVVLDGETFSPVRYIKQDG
LISAIYELYSEDKAVFSFKNRPVIGFLDTKNFKISYLKIKEPYEDFFIDPFERFIIGTSR
KGTVLSVYDIRKEKEVFNYPIEGMPHLASATYWYRDGKFYFATPHMIMPYVTVWQMYNWK
FVKKVNTEGNGFFVRTHPSTPYLWTDNGKDKVILIDKTDYSVKSIETFKGKRVIHTEFSG
DGKYAYVSLYNRDGNLLIYDSITLDLLKNIPASIPIGKYNIINKSRKYAPVLLGREVFLK
KCWGCHHETQEAFAPSFRWIVNRRDRSTIVAHILNPEGMYKALGYSRNAMPQLNLSEWEL
EAVVSYMMEFKDAQNN
Download sequence
Identical sequences C0QTT5
123214.PERMA_0307 gi|225849866|ref|YP_002730100.1| WP_012675226.1.53201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]