SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|225849868|ref|YP_002730102.1| from Persephonella marina EX-H1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|225849868|ref|YP_002730102.1|
Domain Number 1 Region: 7-351
Classification Level Classification E-value
Superfamily C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 7.59e-41
Family C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|225849868|ref|YP_002730102.1|
Sequence length 352
Comment heme d1 biosynthesis protein NirF [Persephonella marina EX-H1]
Sequence
MLHLIMVFLISFSTVFAEKLYVVERERGSLAVIQDGKFEGEIRDLGNLNHAIVKTDGDYS
YVISRNGYFSKVDNRSDRVVRKIKPGNSGIGFTFVGDYIAIAHYDPKKVTILTKDLDKYI
VVETGSRNVGIKVYYPYLVFSLMDKDQIWVLNADKGFELETVIDNVGKLPFDALIDGDRY
IVGFFKEKGVGILDLSNFKYRKVKFRSDKDQEVVFKIPHFGMWGIVDERAIIPSVGERKA
YVVNIKSMKVEKSIDLIGLPVFISVSPDRRFAVVNYSGDKEDYITVIDLKDFKPVKNIKA
GKRVMHLRFSKDGKRLYISSYFENRLKIFDTDNFRIIKEITVPTPSGIFIVR
Download sequence
Identical sequences C0QTT7
123214.PERMA_0309 WP_012675245.1.53201 gi|225849868|ref|YP_002730102.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]