SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|229820913|ref|YP_002882439.1| from Beutenbergia cavernae DSM 12333

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229820913|ref|YP_002882439.1|
Domain Number 1 Region: 14-260
Classification Level Classification E-value
Superfamily Cgl1923-like 9.81e-84
Family Cgl1923-like 0.0000016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|229820913|ref|YP_002882439.1|
Sequence length 315
Comment hypothetical protein Bcav_2427 [Beutenbergia cavernae DSM 12333]
Sequence
MDARDLYTSEHAEGARVLVHALQGSMDAGHAGALLAQHLLTTLPATRVATFDVDELLDYR
SRRPAMTFEATTWTSYDDPVLAVDLVRTPTGEGVLLLHGPEPDLRWERFTTAVRTLVEDL
GVETTVGVHGIPMGVPHTRPTTVTAHATRPELLEGRPSFVGTIQVPGSASSLLELRLGEA
GHDAMGFAANVPHYLAQAEYPQAAAELVRQINSSTGLDLPVGELEASASSTREEIDRQVA
ESDEIGAVVHALEQQYDAFSRGLAAEDARTLLAQDRLPSADELGAEFEAFLAEHAPGEPD
AGGDADGTQDDGPAS
Download sequence
Identical sequences C5BW76
471853.Bcav_2427 WP_015882917.1.13559 gi|229820913|ref|YP_002882439.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]