SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|240102207|ref|YP_002958515.1| from Thermococcus gammatolerans EJ3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|240102207|ref|YP_002958515.1|
Domain Number 1 Region: 92-238
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 5.1e-35
Family AlaX-like 0.003
Further Details:      
 
Domain Number 2 Region: 1-90
Classification Level Classification E-value
Superfamily Translation proteins 1.34e-16
Family AlaX-M N-terminal domain-like 0.00078
Further Details:      
 
Weak hits

Sequence:  gi|240102207|ref|YP_002958515.1|
Domain Number - Region: 264-295
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0981
Family Mitotic arrest deficient-like 1, Mad1 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|240102207|ref|YP_002958515.1|
Sequence length 405
Comment Alanyl-tRNA synthetase-like protein [Thermococcus gammatolerans EJ3]
Sequence
MTEKLFYRDPYLRETRAKVLHVEKLGDRVRLLLDRTIFYPEGGGQPSDRGFIEGNGFRVL
VDRVYGKDKIWHEGKLEGRFPEKGDEVRLTLDWEWRYENMRAHTGQHILSAVIKGLLGAD
TTGFQIFPEHGKIEIDYPGELSWELVNEIERKTNEIIWGDVEVEVEVYEELPGELSERLR
KPLSEKVKPPIRIVKIGTVDVTPCGGTHVRSTREVGVLKVLNFYRKSRKLWRIEFATGNR
ALRALNEILKDYWGSLEEMPNKNRPLRERVIELRSELEKLEEEKSKLRRELWRWKAEALI
KNARKIDGVRVITLVEEWPMKDAQAFAIYLVEHNPGTVVLIAGENYVVFAKSEKLDVSMR
SLLRAVLAEVGGGGGGSDNLAKGGGFRVSPREVLDIAVKKLGELL
Download sequence
Identical sequences C5A339
gi|240102207|ref|YP_002958515.1| WP_015857771.1.60195 593117.TGAM_0149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]