SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|240102469|ref|YP_002958778.1| from Thermococcus gammatolerans EJ3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|240102469|ref|YP_002958778.1|
Domain Number 1 Region: 13-42
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000942
Family Classic zinc finger, C2H2 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|240102469|ref|YP_002958778.1|
Sequence length 62
Comment Zn-finger protein [Thermococcus gammatolerans EJ3]
Sequence
MVELKAITFIDRDGELYYRCPRCGMVFRKSRDYIRHVNKAHGWLFRGGRPKGKRALKKLG
KE
Download sequence
Identical sequences C5A3V2
593117.TGAM_0412 gi|240102469|ref|YP_002958778.1| WP_015858032.1.60195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]