SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|240103330|ref|YP_002959639.1| from Thermococcus gammatolerans EJ3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|240103330|ref|YP_002959639.1|
Domain Number - Region: 211-292
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 0.000785
Family Terpene synthases 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|240103330|ref|YP_002959639.1|
Sequence length 296
Comment hypothetical protein TGAM_1273 [Thermococcus gammatolerans EJ3]
Sequence
MTFLELLGFRGFGNFLSPAGDIPPMRRVPLMGIVIVLVIITIFVSTRNPSVQEPSVTAMR
SFLESQYVPEAGLLRASVTTYPDNVTIWLANDNLLAVKALKLSGSPLWRNVSVALSLYNV
SSNDRIDPLLGRPLSGFFCPMIVEVGEVRSVKFNTTFELKLEKGNASCPMQDWEEYADLL
VYGALSELLRGNREGAEKLYLELMTLWDGNGFRDKAFNGVYQSYKCALFVYLNRALNEKT
GRDIRIRCLKILSALQAPNGGITTGYVVKNGKTVPIGDQNTETTSMVIIALLSHSP
Download sequence
Identical sequences C5A6B3
gi|240103330|ref|YP_002959639.1| 593117.TGAM_1273 WP_015858887.1.60195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]