SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|240103692|ref|YP_002960001.1| from Thermococcus gammatolerans EJ3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|240103692|ref|YP_002960001.1|
Domain Number 1 Region: 85-210
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 6.28e-31
Family AlaX-like 0.00000144
Further Details:      
 
Domain Number 2 Region: 1-84
Classification Level Classification E-value
Superfamily Translation proteins 1.38e-21
Family AlaX-M N-terminal domain-like 0.0000115
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|240103692|ref|YP_002960001.1|
Sequence length 213
Comment Alanyl-tRNA synthetase related protein [Thermococcus gammatolerans EJ3]
Sequence
MTRKLYYEDAYLREAKAKVLEVKENALLLDQTIFYPTGGGQPHDRGWINGVEVLDVYKDE
EGNVWHVVKEPEKFKPNQEVELKIDWDYRYKLMRIHSAMHLLEHVLNLVLPGKWELYGSG
MSVEKGRYDILYPENVNKWKQEIIETFNRLVDEGGEMKIWWEGETRYTQIRDFEVIPCAG
THVRDIREIGHLKKFKRSSLGKGKQRLEIWLED
Download sequence
Identical sequences C5A7C5
gi|240103692|ref|YP_002960001.1| WP_015859248.1.60195 593117.TGAM_1635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]