SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|240103804|ref|YP_002960113.1| from Thermococcus gammatolerans EJ3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|240103804|ref|YP_002960113.1|
Domain Number 1 Region: 402-661
Classification Level Classification E-value
Superfamily Pectin lyase-like 7.12e-25
Family Pectate transeliminase 0.06
Further Details:      
 
Domain Number 2 Region: 3093-3300
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000000387
Family Galacturonase 0.05
Further Details:      
 
Domain Number 3 Region: 2560-2777
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000000576
Family Galacturonase 0.059
Further Details:      
 
Domain Number 4 Region: 954-1045
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000725
Family I set domains 0.036
Further Details:      
 
Weak hits

Sequence:  gi|240103804|ref|YP_002960113.1|
Domain Number - Region: 2979-3047
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0298
Family beta-Galactosidase/glucuronidase, N-terminal domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|240103804|ref|YP_002960113.1|
Sequence length 4610
Comment hypothetical protein TGAM_1747 [Thermococcus gammatolerans EJ3]
Sequence
MEVIHVKVKKSALFLFYLLISSYLNVGFVGFLHPVQAQSPVFQDDFNDNSLDTSKWTEDV
VGSGNSYTEANGEAQFITHGGRTGNYGTEHAFLRSSVISIENWSYVVFSGKWKFTDPGTA
EMWFRIYDADSGKYLGVRYVSWTTEIAYDRVEGTISESRSAPQTYVPFRIVLYKDHFEYW
ENGNLVKTIETITMESTTNFQLVIGGWDDTPTDSHMYFDNIVVEYEEAAPPEESLKVTIL
SPEERTYNTATIDLNVTANKPVDEWRYSLNGGKNVTFEPNTTITAQNGENLLVVYALAGD
ETGVAQVNFYVNASGEDETPPGTVRNLAHEVGADYIHWTWDNPEDEDFETALVYIDGKFE
GETDEGEWWLDELLPGETHTIGILTRDYSGNVNTTWVNDTATTLTPAETVYVNESGWWYE
GGSLNPSETPLQDGIKNAIEGGTVVVLAGTYPESVEIGKFLTVETSESARITGDGSELDT
GRKPVFYVSSNNVVLRGFVIPSSVSNIGVWVDGVENCTIEDNTITITETGESERYGIYLS
YGGGNIIRDNDVSVSGFQGVGIYVYEEEGEASDVHDNTVTVRGDSADGIEVFYTSTWVYD
NTISISGVGENAGYALYLYLAGDSFIDNNELTTNLSETNAWAIIVIAEFYGSLSGNTING
IPTEVTCPGNCLVRGVPPENRPAPPEGYGDVGEYIEIDVDSWLHLGLYYDDSALEGLNEN
SLQIWHFTEGWTLDGTSGHHLDTNKNLVEANLTGLGIFAPLAQEENDITPPVLTFVEPTP
KDGSLIGDSSVVINVTSNENLTMATLEFDGANHTMLGSGKEWHYTMSVADGTHTFRVYGQ
DLAGNNGTSEEREFEVDTKAPEYSNVGQDAEGIPPGGEVHVHAFWSDPHLRGAVLYTNIT
GSWEVFDEVVFEGTEGWSNFSISMDEPDLYCWKITGYDALDHESTTPVHCFVVYSPPEIV
SYSPESPVESYVGDTVEFSVTVDQTVNVTWYLDGSIVKTEENVETSTYTNSDVGEGEHSV
RAVVENSNGSASHFWAWYVYPKPGLTVSFVEPTPENGAMLNVRRVIINVSSSLDLDNATL
EWNGANESMSGSGRSWWAVKENLADGTYAFRVYGSAEGITNHTEERTVEIDATAPRFLEY
GQAEDEVMAGDKAKVFAKWTDAHLEGAVLVTNATLVDGTFVWSEVPLQIANGWSNGTIST
EENFAGKVFCWYIKANDTFGNGNETPKLCFRVEEGLRIVSFSPESNDITVWDNESVSFSI
ELNKAANVTWFVNNTEVLAEEGTYSEYHNDTLIPGVWNVTVVARRDGREVSHSWKLTVKT
DTTPPVLTFLPPTPENGSLVGDSLVVFNLTSSEELSQATLYFDETAYPMEGSGREWWVSL
NAGDGNHEFHATGKDMHGNEGATGVVVFEIDTTAPRYVSYGQESESVLQGEDVTVYALWN
EAHPSIAKLKTNATESGEWTTVVTSEYSSWTNFTISTEGLSGGTYCWIIEAEDTLGHVNS
TPLECFRVIEPLKIVSSSPEGEEVEVFQNETVTFSIALNQVANVTWAVNGTVVLEEEGNG
STYTNSTLIPGLWNVSVRAENENGVARRWWLMRVVKRESPLKIVVLAPENGSRIKGSWVT
VEAEASRELLLAVLELDGVNHTMLGSGRSWNLNVSLTDGHHVLRIYGMDAAGTRAKSGEL
TFESDGNPPEITVNCPDTVDEGDLVTVEVSIHDIHPASYEIYRDSVLQEEGIYSSNTTLR
VVFQAHEPGMVEYKVWANDTFGWESERTVQIRVRDTTPPRLILLPPTPENGSILNKNSVK
FRLLSNENLSRAVLNFNGAVYVMMGSGRNWSISLTIEDGHYEFYVGAWDTAGNFNETEHR
TFTVDTTPPELWFIQPTPENDSLLGASQLTFNIVAGERLSSALLELDGVNHTMEGDEEDW
NITIPIPDGRHVFRVYGIDLGGNIGSTETRVVETDTAPPVVHDKLVNLTLEWERDGIYST
HAERGLKAGLLINVTEPHPGHYDVYFNPDANDPNHGWVELYSGNYTSGVPFFVRFNTSEP
AYVMYYIEVYDALGHGTYGKYFFLRVRDTVPPAKIEVLAVTTFAGGAEVGWINPSDEDFN
HTELWINETLVGNFTGEPGLWDGTTLTLTPGETYNISVVPVDRYGNRGEATWKSVTIPYP
SLNAGYALLTPSDGAELPPETEEITVRIESSDSFASCTLSWDGHYYRLRVKTAWISYIDD
KGHLHTKRIYYCEKTFSGHLNGEHSFYAVVYDGYGHFRSLPTRHITVKWPCFKDCTLEIT
SPRGNVMNLLVPINFTMDTNAPPTNYTFTIENIEHTEPFTPNVSYSWVDDHLSLNGSFLL
DLSPFMKELKEEGARGELLSLVITAMDSCGRELRAETEFSVCSGNERPELAVKIVDEARP
GEEVILHAEVKDKNGNLQGIYVSINGGEYMDYSEDMDISPYLQPYANNVVRVKAVDTCGA
ATVEAFKVRISGPPVQGDWLVNNTQLCSGKSYTVNGSILITSRGSLELRNCQISVLGDGV
QVNGTLKVLQNSVIRGTSLNLSGENGNMDVSDSRLSGFEGGTFTGNAEFISSTLDGEFNF
SLSNVTVRNSDVNGGITVSGSLNVENSIFHRGMGLTYLRPVWNSPGSLRIVNSTFRNNEF
GIKFLGVASDWHWTMENLLIENNRECGLCLEAPRYGYATEELKNVTLRNNGKGVCAKNVR
LSFRDSLIESNGERNFELDLSNNWIYLYDTNVTGSEYAFHAQNVGGIELHDVNLTGDVSP
YPGYLMVYVSGGKVSTLESGKAGRLYAHVNGKLRLRSYTVEGGKIEVKPEGTLRVEDVDG
IPATDDLDKDASVLRNIIIEGLSSNIGQSHIVILNSRLEGSTFGTLSTDALITGCRIDGG
SVSFSTWMFWSHENTEVRETAVGENAEWFYSMSKPADNWMYTTETTGMSTGSAPFSADMY
HSSFTSGTEVGEFTDLYLKKVVNFEKLPVQAWLNYYAISGVEIYVNGKKVVDELNHEAQL
SFVYGWGGGRISATPLIDFVDLAGYLRSGENVIAVHVRSPNRYPYLQLGAFEATLYTVSG
VAGLRDSVVNAPVYGSAARLIIANDEIYSNVTSSFYSRIRISNSRIRGSVKVSGRMEIEK
SEITGDGTGYGVWSENPFDVIINESTMGGFDYGIHLHPMGSSGSVKVISSKITENEVGLW
TYRAAVDVRGSYVMHNTKGMELLSVNGTIYNDLFFDNDVGIDIWVSEGTSTLIDHNTITG
GNVGISIPQGSGGVVSLTNSLVQNNDLGIFMAGNAVLTLENNSLVNRKGIHLTTGASAIN
NTDWGGHEPRLVENFTGGTMYTASGEVETNYDILDERGAVSLGSTVSTGPGWGSSLLGVS
LDVYPMSNGDVKGVISLAGGASSRSPIVAVNYTLIYNGMEELLNESSLNSTEYYGYITLD
TVGKNLTGTGYLKFTAKNAEGTSISAIRKVYFRNVDIKIVSYSISHPTAVYVYRRDPDVF
GTAIPYDERFANVSVLLKNIGELTGVAKIELVLPEYIERHTGKVSLLVAVPGNMEGYFNA
LIPITDFDPITLRWDPLPDELPSDGKIPIKIRLYDLDGVLRDERNATIEFDLGPVFKING
YDAYPYTRQWCQISGECSVKNYGLNSYTYDGDGDGNLEAAESHHFDLIIENIGDREVYLK
SLSVRDYIPERDPNLHNKLLKRNSVTLLGGSDETFMADVWAKNLTRLVKPGQVRYVYGAW
MPWWLDAPPTYIPPVNFSGEYMSTANVLYYETINGQPLPGYYVTIPINYMKTPVKALDKS
FVPFTEYVGPVQVDVIGVNGDKTYLKLKNTNDNIYYSYYAEGDYDMEPEGYVWYHVIPPG
FEFRAIADHSKEPGTVIPHYRVTVGVEYSLLFNEIDLIAIGVEGALGVYDIDVPVRTIVA
AMAKSMLKITNIVENIDFPDEDKNFTWMAQNSPETNALIEADDATYAAVINLDTMARLEQ
NYGMDRDFYEDVANFDSLSLPEEIEVVKKYGTAIIGDEDLQMLLLETVLEIVDNDILNEI
YKEAQDAANPPSPEEEMAEEFSEASKKAAKEIAQELIVKELKKKKSFQSLSPKEQKKALK
DAKGTIAAAVDTFITLGEWAFYNIYATLTQPTPMSIQVLDPPANYTVEAQKFDTAILLGG
EGGSLDGWGNVSLTFGEPDVYRAEYIVPTPLMRVGPLFNGTLEGMSVEITGTRKGAMLGE
LRMELRPDPRNASMVFAIFRNEAFARAFVSPYLTKVDSLDVEIKDNTIILSAKGELVALP
EDEGIHITMNAGKLFTNATIERMGTYRGSVELRSAFGIDPSKVETTVGGSVKILEGNEDG
SVLIAVPKNGTLEPPEVTITPEKLYTGGEVTIKTSKPCSLSWKLGNLAGSGDFVPTRGLK
AGNYTLTVTCLYGNLTEKKNYTVELVEKPITEKEADGDIVSAEPGKWVRVSTRTDLYRIY
FLPKVKVNGMVAVYQRPGDVEAPEGYDYVTYSIFNVTHPENLSIANATLRFRVSKEWLRA
SNVSKDSLLLLHLENGWVEYGPVFEYEDLEYVYYRVNVPSLSLFAVASKVKVETHEEHET
PTETPTHTESPAETTSTPVQSSQEGGNTACYILAALAILVLIGVYVYRRR
Download sequence
Identical sequences C5A1I0
gi|240103804|ref|YP_002960113.1| 593117.TGAM_1747 WP_015859358.1.60195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]