SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|240103007|ref|YP_002959316.1| from Thermococcus gammatolerans EJ3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|240103007|ref|YP_002959316.1|
Domain Number 1 Region: 26-270
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 5.9e-50
Family Biotin biosynthesis protein BioH 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|240103007|ref|YP_002959316.1|
Sequence length 279
Comment Lysophospholipase [Thermococcus gammatolerans EJ3]
Sequence
MRILTFFRSNGFGWVVEMGVYKVKFGEPELGWVVLVHGLGEHSGRYGRLIRELNEAGFAI
YAFDWPGHGKSPGKRGHTSVEEAMEIIDSIIEELGEKPFLFGHSLGGLTVVRYAETRPDK
IRGVIASSPALAKSPETPGFMVALAKFLGRVAPGLVLSNGIRPELLSRSRDAVRKYVEDP
LVHDRISAKLGRSIFVNMELAHREAERIRVPVLLLVGTADIITPPEGARKLFKRLKVEDK
TLREFEGAYHEIFEDPEWADEFHRAIVEWLVERVRNKPR
Download sequence
Identical sequences C5A5E0
593117.TGAM_0950 gi|240103007|ref|YP_002959316.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]