SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|256420432|ref|YP_003121085.1| from Chitinophaga pinensis DSM 2588

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256420432|ref|YP_003121085.1|
Domain Number 1 Region: 22-90,130-206
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000000000654
Family SMI1/KNR4-like 0.0084
Further Details:      
 
Domain Number 2 Region: 261-419
Classification Level Classification E-value
Superfamily ARM repeat 0.0000131
Family PBS lyase HEAT-like repeat 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|256420432|ref|YP_003121085.1|
Sequence length 455
Comment hypothetical protein Cpin_1387 [Chitinophaga pinensis DSM 2588]
Sequence
MVLFDEQIRRIKDKLSQARNVDKYLTVLGAKNHKYQVNEPVAAEDILKLEEQYGVSFPDC
YRSFLLQVGNGGTGYEDSAAGPYYGIYPLGRNIKELIGDKAEEYLKNDCVIYPDMSAEYW
QSLNAKIDDDEELSDEELYRELGKIWGGVIPIGSQGCAYIHGLIINGAYKGRVVNISMDG
PKPQFTFEVNFLDWYERWLDEVISGQLLQDGVNWFGYAMGGPDTTMIHLFLETGSIKEKE
ECLKGILCKHKLEAETIEIVEEQLLNGSKEFKQDLLHILTKFDYGRAKPYLVDLARTDIG
SVCSMIRWYAKSTSVEWVPLIRKYIADVDDAEKFRFCTYLLADATADFGDLIVPFAEREH
EEMQVTAFYTLGKLKNKSDFLETFIKGLNASSNRVIHSALQALSDVYDIRLLQHYKRIAE
KFPEEKDYILSNLNHRLAAYGLNNKTILLKNDLGE
Download sequence
Identical sequences C7PRJ1
gi|256420432|ref|YP_003121085.1| WP_012789060.1.2976 485918.Cpin_1387

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]