SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|256425847|ref|YP_003126500.1| from Chitinophaga pinensis DSM 2588

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256425847|ref|YP_003126500.1|
Domain Number 1 Region: 8-144
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 1.57e-29
Family Single-domain sulfurtransferase 0.01
Further Details:      
 
Domain Number 2 Region: 132-220
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.12e-24
Family Thioltransferase 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|256425847|ref|YP_003126500.1|
Sequence length 222
Comment rhodanese domain-containing protein [Chitinophaga pinensis DSM 2588]
Sequence
MIYKYYIYLLFGSILFSVSNRVNAQEVNAVVFNDSIRNGNVQVFDVRTAGEYNTGHLSNA
LQADYTKKEEFMERVKYLDKDKTVYIYCLSGGRSAKAASWMRGNGFKKVIELEGGINAWK
QAGEPVEGTADVKQMEVDAFRADIGKGEVLVDVGAEWCPPCRKMAPVLEAYLSEHKTVRL
LKVDGGRDQDVMQSIKVTSLPTFILYKDGREVWRKQGVYEQL
Download sequence
Identical sequences C7PQ61
WP_012794462.1.2976 485918.Cpin_6898 gi|256425847|ref|YP_003126500.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]