SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|222054691|ref|YP_002537053.1| from Geobacter daltonii FRC-32

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|222054691|ref|YP_002537053.1|
Domain Number 1 Region: 26-148
Classification Level Classification E-value
Superfamily Multiheme cytochromes 2.62e-16
Family Cytochrome c3-like 0.00083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|222054691|ref|YP_002537053.1|
Sequence length 174
Comment hypothetical protein Geob_1594 [Geobacter daltonii FRC-32]
Sequence
MYTGLKNIKTFIFMIALGAIPYICQGADLPDMISLDSLVKNYDSVEFNHAQHIRLLKDCA
GCHHHTTGNLVEDANCARCHQNSSGTKVVACRGCHSAQPFSAEALKEKRANLKLYHQDKP
GLKGAYHLNCMGCHEKMGGPTGCRDCHRMNRTGEALYNSGSFTPKKTGKVAKGH
Download sequence
Identical sequences B9M5X1
gi|222054691|ref|YP_002537053.1| 316067.Geob_1594 WP_012646681.1.88144

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]