SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|222053288|ref|YP_002535650.1| from Geobacter daltonii FRC-32

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|222053288|ref|YP_002535650.1|
Domain Number 1 Region: 346-585
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.19e-74
Family Extended AAA-ATPase domain 0.00000103
Further Details:      
 
Domain Number 2 Region: 171-315
Classification Level Classification E-value
Superfamily GAF domain-like 2.18e-18
Family GAF domain 0.012
Further Details:      
 
Domain Number 3 Region: 12-123
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000314
Family PYP-like 0.04
Further Details:      
 
Domain Number 4 Region: 560-646
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000013
Family FIS-like 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|222053288|ref|YP_002535650.1|
Sequence length 656
Comment Fis family transcriptional regulator [Geobacter daltonii FRC-32]
Sequence
MKSSSDFFLEKFRELEDLFADLQFGFAVLDRDLHFIHVNGQLAKIDGKPVEQHAGRSIED
INPQIALAMEPILLRVMRDNRPFFELAVDIHSTAAAHTAMNNTWQVRCYPLNADDGEVLG
VSLVVLDVTEQKLREAAQIERLQFESLLSTLSTTFINVPVSEVDSKIVQGLQKIVDFLGF
DRSTVWRVDPDTGEMICTHSYELPGIMPPLPILPPDMVPVWNSMVKSGEIFKISDSDELP
ESFQREKLYCRDRGGIRSIMFIPSRVGGVVEGFITFVSYSVIRAWPDDLIQRLRILWEIF
ANALERKRADQKIQHALAEIKTLKDRLEAENIYLRDQIDIEYKPDDIIGQSTAIRGVLRQ
LQQVAHTDSTVLLLGETGTGKELLARAIHNLSGRRERSMIKVNCAALPATLIETELFGHE
KGAYTGAAARHVGRFEAANGSTIFLDEIGELPLDLQSKLLRVLQEGQFERLGSTRPIDVD
TRVIAATNRDLAREVKEGRFREDLYYRLNVFPISVPPLRERKEDIPLLVSAMVKEFAGAF
GKTIERVPKKNMDALVHYTWPGNIRELRNMVERAMILSNGPTLEIDIPDGTPTTVARAAL
LKEVEQLHILSIMEKTGWRIRGKNGAAELLGLKPTTLESRMKKLGIKRCLSSSEIS
Download sequence
Identical sequences B9M8L4
gi|222053288|ref|YP_002535650.1| WP_012645278.1.88144 316067.Geob_0176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]