SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|222053945|ref|YP_002536307.1| from Geobacter daltonii FRC-32

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|222053945|ref|YP_002536307.1|
Domain Number 1 Region: 342-397
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0000055
Family alpha-D-mannose-specific plant lectins 0.0056
Further Details:      
 
Weak hits

Sequence:  gi|222053945|ref|YP_002536307.1|
Domain Number - Region: 218-323
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 0.00432
Family Integrin alpha N-terminal domain 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|222053945|ref|YP_002536307.1|
Sequence length 494
Comment hypothetical protein Geob_0844 [Geobacter daltonii FRC-32]
Sequence
MKKITTCLSVLFSLFLTAVPVFAEAIPVHVNEFTVNGAPERADLKGTLQMLLASRLSNGA
VSTAGSQGTAEIAVDCSYTQLGKVFSLDAVARDRAGNVVARAFEQGGGEDDLIPAVTKLA
QKLNDEMVRVRSTPSAGKNVAFAQPSSSPPRAEPQPAAPVPSSDIIRVEPAAKNSVNLSR
LAVALVGVAPGRTLAKGARELYLLGEHSLSLYHQDADLKMIAEATFDINDKPIGIDTADL
DGDGTPEAYVTIVRGDLLSSQVWLEKDGRLQKVAEKLPYYFRALALDGGARKLYVQQMGT
DTDFYGDIHELVIKGSSYEMRNPLKLPRFANLYNFNRFSDATGKHYTLVIHEDGYLLVYS
ETGEELWRSSDKFGGSEIYLKRQDLANIRTTGNEYRWIFLEQRIFVTPQNEIIVPKNLGF
FVFGNNRSYKKNTVYAFAWNGSTLDEKWHTKESQNYLADYDYDSVRKELILLEVVKKKGL
LENGASTIVVKKVE
Download sequence
Identical sequences B9M1R0
WP_012645935.1.88144 316067.Geob_0844 gi|222053945|ref|YP_002536307.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]