SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|145590327|ref|YP_001152329.1| from Pyrobaculum arsenaticum DSM 13514

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|145590327|ref|YP_001152329.1|
Domain Number 1 Region: 87-172
Classification Level Classification E-value
Superfamily SMAD/FHA domain 6.12e-18
Family FHA domain 0.0013
Further Details:      
 
Weak hits

Sequence:  gi|145590327|ref|YP_001152329.1|
Domain Number - Region: 26-53
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00541
Family Ran binding protein zinc finger-like 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|145590327|ref|YP_001152329.1|
Sequence length 175
Comment FHA domain-containing protein [Pyrobaculum arsenaticum DSM 13514]
Sequence
MWLRKLLKPAANYLSFLTLYFEWAMPWRCPVCGTENRDEALTCRVCGAYKPEATTKRLQV
AKETALPYVVVSVEVLESPVESLVGKKFEFMIEATGAIVTVGRAVDNQVVIPDPTVSRRH
LRLIVTSNGIVVEDLGSSNGTFLLEGGSERRVRAENVGRQALIRIGHTKLRLTLS
Download sequence
Identical sequences A4WH10
340102.Pars_0060 gi|145590327|ref|YP_001152329.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]