SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|145590723|ref|YP_001152725.1| from Pyrobaculum arsenaticum DSM 13514

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|145590723|ref|YP_001152725.1|
Domain Number 1 Region: 52-118
Classification Level Classification E-value
Superfamily Nucleotidyltransferase substrate binding subunit/domain 0.0000902
Family Family 1 bi-partite nucleotidyltransferase subunit 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|145590723|ref|YP_001152725.1|
Sequence length 134
Comment hypothetical protein Pars_0475 [Pyrobaculum arsenaticum DSM 13514]
Sequence
MAVLKELARSVLGYAAELDAYTKEDLEDAKKLYGAMYLLMSQSQALIDMAERAASLLGVA
PRGYIDAGKILATHGVFSEEDLAHYISIVKFRNILVHKYQIVKTEIIKDSVLNRKYKKAV
ELALKILRHFEEDP
Download sequence
Identical sequences A4WI56
gi|145590723|ref|YP_001152725.1| 340102.Pars_0475

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]