SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|145591132|ref|YP_001153134.1| from Pyrobaculum arsenaticum DSM 13514

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|145591132|ref|YP_001153134.1|
Domain Number 1 Region: 23-79
Classification Level Classification E-value
Superfamily SirA-like 0.0000536
Family SirA-like 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|145591132|ref|YP_001153134.1|
Sequence length 81
Comment hypothetical protein Pars_0898 [Pyrobaculum arsenaticum DSM 13514]
Sequence
MRIVARYSFSRDDSCHKMGLRHPAYILMEHLQRLAPGEAVEAATDDADWALTIETIAKAA
GFKVEKRAEGPVAVLLIQKIL
Download sequence
Identical sequences A4WJB5 H6QAJ6
gi|145591132|ref|YP_001153134.1| 340102.Pars_0898 gi|379004411|ref|YP_005260083.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]