SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|145591892|ref|YP_001153894.1| from Pyrobaculum arsenaticum DSM 13514

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|145591892|ref|YP_001153894.1|
Domain Number - Region: 155-177
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0794
Family Classic zinc finger, C2H2 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|145591892|ref|YP_001153894.1|
Sequence length 193
Comment hypothetical protein Pars_1691 [Pyrobaculum arsenaticum DSM 13514]
Sequence
MICILTSTIQSSQLATSQICFKPKLGLVSPNKTCDVLYKNIGTAVPNCVYIDAMLGWLAR
ILRILFGATVVYSPDAEDVELVETECLVVTRDEELFRRRRGPTILLKTDDHVKWVSVFLN
LGMRPFEKSVCPLCGGELEEVDCGEAEAAVGHKIRSEKCWRCARCGKYYWVGSHWRRLRR
LVEEAKAVAPCSG
Download sequence
Identical sequences A4WLH5
gi|145591892|ref|YP_001153894.1| 340102.Pars_1691

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]