SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|145592509|ref|YP_001154511.1| from Pyrobaculum arsenaticum DSM 13514

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|145592509|ref|YP_001154511.1|
Domain Number 1 Region: 51-99
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000096
Family Classic zinc finger, C2H2 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|145592509|ref|YP_001154511.1|
Sequence length 104
Comment zinc finger C2H2-type domain-containing protein [Pyrobaculum arsenaticum DSM 13514]
Sequence
MATELCFACTDKDYARPATTITCSVCKKEVSWREAVTHYMGHGKKSGNDVVCPICNTKVK
QQEYRNHVRRHFAAKRGLFYICGICGRSFVTLRSLLVHISKTHE
Download sequence
Identical sequences A4WN92
340102.Pars_2315 gi|145592509|ref|YP_001154511.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]