SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|153938941|ref|YP_001390122.1| from Clostridium botulinum F str. Langeland

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153938941|ref|YP_001390122.1|
Domain Number 1 Region: 1-476
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.5e-160
Family Clostridium neurotoxins, catalytic domain 0.0000918
Further Details:      
 
Domain Number 2 Region: 465-796
Classification Level Classification E-value
Superfamily Clostridium neurotoxins, "coiled-coil" domain 1.15e-117
Family Clostridium neurotoxins, "coiled-coil" domain 0.00048
Further Details:      
 
Domain Number 3 Region: 806-988
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.87e-38
Family Clostridium neurotoxins, the second last domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|153938941|ref|YP_001390122.1|
Sequence length 1163
Comment botulinum neurotoxin type A1 nontoxic-nonhemagglutinin subunit [Clostridium botulinum F str. Langeland]
Sequence
MKINNNFNIDSPVDNKDVAIVRGRKTDIFLKVFQVAPNIWVAPERYYGESLNINEDQKSD
GGIYDSNFLLTNDEKDEFLQATVKILQRINNNVIGAKLLSLISTAIPFPYEYKPGDYRQT
NYLVSKDNQHYYTANLVIFGPGTNIVENNAVYYKKEDSENGMGTMSEIWFQPFLTYKYDQ
FYVDPALELIKCLIKSLYYLYGIKPSDDLSIPYRLRSELNSLKYSELDMVDFLISGGTDY
KLLNTNPYWVTDNYFSDAPKNFEKYKNDYETKIKNNNDIANSIKLYLEQKFKINAQDIWE
LNLSYLSTEFEIMMPEIFNNALNHYHRKEYYVIDYFKNYNINGFINGQIKTILPLSKYNK
NIINKPELIVNLINENNSVLMKSNVYGDGLKGTMNNFYAVYKIPYNIGDEYHINYSYLNN
VNVEEINNIPPINDADIYPYRKNSDPFIPVYNITETKEINTTTPLSVNYLQAQVTNSNDI
NLSLDFSKVISLKDRSLVYSFLDNTIDYLDSIKYDEPINTDKKYYLWLKEIFRNYSFDMT
EIQEVNIPCGINKVVPWLGKALNILNTGNSFIEEFKTLGPISLINKKENIIMPKIEIDEI
PNSMLNLSFKDLSENLFNIFSKNNSYFEKIYYDFLDQWWTQYYSQYFDLICMAKRSVLAQ
ESLIKKIIQKKLSYLIGNSNISADNLVLMNLTTTNTLRDISNESQIAMNNVDSFLNSAAI
CVFEGNIYPKFISFMEQCINNINKNTREFIQKCTNITENEKLQLINRNIFSSLDFDFLNI
ENLKSLFSSETALLIKEETSPYELVLYAFQEPDNNAIGDASAKNTSIEYSKDIDLVYGIN
GDALYLNGANQSISFSNDFFENGLTNSFSIYFWLRNLGKDTIKSKLIGSKEDNCGWEIYF
QDTGLVFNMIDSNGNEKNIYLSDVSNNSWHYITISIDRLKEQLLIFIDDNLVVNESIKEI
LNIYSSNIISLLSNNNASYIEGLTILNKPTTSQEVLSNYFKNLNNSYIRDSNEERLEYNK
TYQLYNYVFSENPIYEIKQNNNIYLTINNTNNLNLQASKFKLLSINPNKQHVQKFDEVII
SILDNMEKYIDISEDNRLQLIDNKNGAKKMIISNNIFISNCLTLSCGGKYICLSMKDENY
NWMICNNESNIPKKAYLWTLKEV
Download sequence
Identical sequences A7GBG2 Q45850
441772.CLI_0850 gi|384461195|ref|YP_005673790.1| gi|153938941|ref|YP_001390122.1| WP_011987709.1.24613 WP_011987709.1.68062 WP_011987709.1.82254 WP_011987709.1.96435

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]