SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|150024789|ref|YP_001295615.1| from Flavobacterium psychrophilum JIP02/86

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150024789|ref|YP_001295615.1|
Domain Number 1 Region: 29-267
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 3.18e-40
Family Endonuclease I 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150024789|ref|YP_001295615.1|
Sequence length 365
Comment Probable extracellular ribonuclease precursor [Flavobacterium psychrophilum JIP02/86]
Sequence
MKKIYLLLLLSTSLGFAQIPTGYYSTATGTGYTLKTQLFNKIKAHTAISYSPGLWNLYYT
SDVRPDGKVWDIYSDCIFVFGTFAATGGNQDTGTLGSNECERYNREHTFPKSWFGGPSGV
PMYTDAFHVMPTDKHDNSLRGNMPYGIVGGTSSYTTNNGAKIGICTAANTPASLIVFEPA
DQYKGDVARNYFYMATCYEDKIASWQKITTDGDAVLDGTSDHVYENWYLNLMLKWHAQDP
VSQKEIDRNNAVYAVQGNRNPYIDHPEYACKIWSVACAALNTNSFELIADINIYPNPSNN
QRVNIETENELDDIQLININGQIMQEIKKPSAQNHTYTLENLPKGFYFLKLSADSRSITK
KIIIN
Download sequence
Identical sequences A0A075RSF9 A6GXH6
WP_011962855.1.100426 WP_011962855.1.10377 WP_011962855.1.15665 WP_011962855.1.16958 WP_011962855.1.22253 WP_011962855.1.27336 WP_011962855.1.27491 WP_011962855.1.30825 WP_011962855.1.31486 WP_011962855.1.32945 WP_011962855.1.33550 WP_011962855.1.3641 WP_011962855.1.40553 WP_011962855.1.40914 WP_011962855.1.43917 WP_011962855.1.45424 WP_011962855.1.50511 WP_011962855.1.53635 WP_011962855.1.61602 WP_011962855.1.68717 WP_011962855.1.73469 WP_011962855.1.75146 WP_011962855.1.76480 WP_011962855.1.76736 WP_011962855.1.80382 WP_011962855.1.8427 WP_011962855.1.87756 WP_011962855.1.90531 WP_011962855.1.91006 WP_011962855.1.94014 WP_011962855.1.94582 WP_011962855.1.94875 YP_001295615.1.27502 402612.FP0696 gi|150024789|ref|YP_001295615.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]