SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|150024814|ref|YP_001295640.1| from Flavobacterium psychrophilum JIP02/86

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150024814|ref|YP_001295640.1|
Domain Number 1 Region: 338-558
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 4.71e-25
Family Endonuclease I 0.0064
Further Details:      
 
Domain Number 2 Region: 202-298
Classification Level Classification E-value
Superfamily CalX-like 0.00000392
Family CalX-beta domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150024814|ref|YP_001295640.1|
Sequence length 657
Comment Probable ribonuclease precursor [Flavobacterium psychrophilum JIP02/86]
Sequence
MIKKLLLLLLFCNSGFSQVVINELDPDTPSTDVLEFIELKSVTPNFLLDGYVLVFYNAGG
APYAGTGSYYALDLDGYSTDVNGIIHFGNPQVSPTPAFILPITTIQNGPDVAALYLGDAT
DFPINTTAHASGLIDALAYSNAATTKPTALMTILGLTTCINENLNSLPATQSIQRKNDGT
YELKVPTPGMNNDGSGIVLNYLRLTTNVSTITEGQSLTVTFSTTNAVTGSDLVINFSLNN
GAFTTADYSGTTSITIPIGQTVGSTVIPILNGRINDGDEEIKIVVGALRTGYSLYNNNII
IRVNDINFVTLPFGSPANPTRGLVASTAPVGYYSSIEGLSGAALKQGLQDIIANPSVIHA
HVYGDIYDILKVADQNPENSNQVWLIYNEAPRSKIDNQTGNSIVGKWNREHIYCQSRGGF
ADATSNTPQGINVWNTSGMPGPNNISTGHADAHHIRAVDGQENSSRNNRNYGVDYNGPIG
NPGTWKGDVARSLFYMAVRYNGLNIINGNPIDTILGQIGDLSSLLQWNRNDTSDDFEMNR
NNYIYTWQLNRIPFIDYPDLADYIWGPKVGLPWSVTLSRPDFNELQIAMYPNPTKDFITI
SGLTHEAKIEISSMAGLNVYKGSYKNNDKLNLNLASGIYMVKIIEDTKWVIKKLIIK
Download sequence
Identical sequences A0A075SCP6 A6GXK1
WP_011962880.1.100426 WP_011962880.1.10377 WP_011962880.1.10561 WP_011962880.1.15665 WP_011962880.1.16958 WP_011962880.1.22253 WP_011962880.1.27336 WP_011962880.1.27491 WP_011962880.1.30825 WP_011962880.1.31486 WP_011962880.1.32945 WP_011962880.1.33550 WP_011962880.1.40914 WP_011962880.1.43917 WP_011962880.1.45424 WP_011962880.1.50511 WP_011962880.1.53635 WP_011962880.1.61602 WP_011962880.1.68717 WP_011962880.1.73469 WP_011962880.1.76480 WP_011962880.1.76736 WP_011962880.1.8427 WP_011962880.1.87756 WP_011962880.1.91006 WP_011962880.1.94014 WP_011962880.1.94875 YP_001295640.1.27502 402612.FP0721 gi|150024814|ref|YP_001295640.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]