SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|150024962|ref|YP_001295788.1| from Flavobacterium psychrophilum JIP02/86

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150024962|ref|YP_001295788.1|
Domain Number 1 Region: 136-192
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 0.00000000000388
Family Intron-encoded homing endonucleases 0.0024
Further Details:      
 
Weak hits

Sequence:  gi|150024962|ref|YP_001295788.1|
Domain Number - Region: 86-155
Classification Level Classification E-value
Superfamily PhoU-like 0.00924
Family PhoU-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|150024962|ref|YP_001295788.1|
Sequence length 264
Comment Putative endonuclease [Flavobacterium psychrophilum JIP02/86]
Sequence
MTNYIKRFYDQEIWKQVELKSPFAEKYELHVSNHGNIKKINILKGTNYNITQTLTQGYPS
VHFTTILPIQEKDQAYFTIIRNSMKFLKLDIASMTEAINLAEKPDTTLAQKIIETQELLK
TINTNYIKNYKKREQKRKRNFSALIHRLVAIYFLEPAPEDKNLVAHIDYDKLNNHHSNLK
WMTREESSLHQRSSPFVIKAKEKVLINGGHRGNTKLDEKQVMILKKRINEGIPLRELAKR
TKVTETQLLRIKRGINWGKVPAAL
Download sequence
Identical sequences A0A076P0A9 A6GXZ9
WP_011963028.1.100426 WP_011963028.1.101623 WP_011963028.1.10377 WP_011963028.1.10561 WP_011963028.1.12512 WP_011963028.1.12753 WP_011963028.1.15571 WP_011963028.1.15665 WP_011963028.1.16958 WP_011963028.1.22253 WP_011963028.1.27336 WP_011963028.1.27491 WP_011963028.1.2967 WP_011963028.1.30756 WP_011963028.1.30825 WP_011963028.1.31486 WP_011963028.1.32945 WP_011963028.1.33550 WP_011963028.1.3641 WP_011963028.1.40553 WP_011963028.1.40914 WP_011963028.1.43917 WP_011963028.1.45424 WP_011963028.1.49619 WP_011963028.1.50272 WP_011963028.1.50511 WP_011963028.1.50736 WP_011963028.1.53635 WP_011963028.1.53668 WP_011963028.1.54396 WP_011963028.1.54855 WP_011963028.1.576 WP_011963028.1.58126 WP_011963028.1.61602 WP_011963028.1.68368 WP_011963028.1.68717 WP_011963028.1.68719 WP_011963028.1.73469 WP_011963028.1.74858 WP_011963028.1.75146 WP_011963028.1.76480 WP_011963028.1.76736 WP_011963028.1.7721 WP_011963028.1.80382 WP_011963028.1.8311 WP_011963028.1.8427 WP_011963028.1.85466 WP_011963028.1.87512 WP_011963028.1.87756 WP_011963028.1.90531 WP_011963028.1.91006 WP_011963028.1.94014 WP_011963028.1.94582 WP_011963028.1.94751 WP_011963028.1.94875 WP_011963028.1.97969 YP_001295788.1.27502 gi|150024962|ref|YP_001295788.1| 402612.FP0872

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]