SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|150026451|ref|YP_001297277.1| from Flavobacterium psychrophilum JIP02/86

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150026451|ref|YP_001297277.1|
Domain Number 1 Region: 50-260
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 1.35e-63
Family DNA/RNA non-specific endonuclease 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150026451|ref|YP_001297277.1|
Sequence length 269
Comment Probable DNA/RNA non-specific endonuclease precursor [Flavobacterium psychrophilum JIP02/86]
Sequence
MRFYYNFLLFFTTVFMFCGCNKQKSDQDKDVVIKNNLASAVVPIDRNYYLPTSTTHVVVE
HSFYTLSYSERYEQAEWVAYELKKNELSHSNLERPYFIDDPEVKTGSASWRNYKRSGYDK
GHLCPAADRRFSRKAFDETFYTSNISPQRNDFNAGIWNTLEQKTRYWAAKYDGVYVVTGG
VLTNNLERIGKEGVAVPNYFYKILLDNSRGEYKVIAFLVPHEASQKSLDSFVVSIDKIEK
MTGIDFFPNLPDGIEKRLETSRNFKGWSF
Download sequence
Identical sequences A0A076P723 A6H2A2
WP_011964510.1.100426 WP_011964510.1.10377 WP_011964510.1.10561 WP_011964510.1.15665 WP_011964510.1.16958 WP_011964510.1.22253 WP_011964510.1.27336 WP_011964510.1.27491 WP_011964510.1.30825 WP_011964510.1.31486 WP_011964510.1.32945 WP_011964510.1.33550 WP_011964510.1.40553 WP_011964510.1.40914 WP_011964510.1.43917 WP_011964510.1.45424 WP_011964510.1.49619 WP_011964510.1.50511 WP_011964510.1.53635 WP_011964510.1.61602 WP_011964510.1.68717 WP_011964510.1.73469 WP_011964510.1.76480 WP_011964510.1.76736 WP_011964510.1.8427 WP_011964510.1.87756 WP_011964510.1.91006 WP_011964510.1.94014 WP_011964510.1.94875 YP_001297277.1.27502 402612.FP2422 gi|150026451|ref|YP_001297277.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]