SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|119025788|ref|YP_909633.1| from Bifidobacterium adolescentis ATCC 15703

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119025788|ref|YP_909633.1|
Domain Number 1 Region: 230-333
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0000628
Family FCH domain 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|119025788|ref|YP_909633.1|
Sequence length 996
Comment ABC transporter [Bifidobacterium adolescentis ATCC 15703]
Sequence
MRIYSKPDAVSTYDVTEGRLPKRTGEIALDMKERDRFAVGSTLNVTEKTDIAGGTVLRHH
KFTVVGFVRASETLSCLNMGQSTAGGGELKGYAVAVPGEFDSDVKMIARATYEDTEGLDY
WSAEYRDAVQKHKDQLVTLLANQPKAREATIRSQQRKKIDEAKDKVKTSKQQLADAQRQL
DDAKQQIDNAKDQLSEGSAEAVEEGSAAAAQLATAQAQLASANASVASGQTQLQAAQTQL
AQGQNQLSDSWNQLANGKTQLDAAREQLETSKTVLDKVGATLGKWEQTGITGKLYEQIRG
KYDMAINQYNEACAEYNRQLNAYNAGLQQYQNAVARLDQGSQAYRSNADNLAQASKQMAE
KQNELGKAVSQAGKQVADGVTQLIQGQRDIDKAETEYQSKLAEFNAQKPEAERKISEAER
QITLAEEKIDNLTVPAYSVSGRREGPTSQGYRVYMVIEGIVAKLADIFPIFLYFVAALVT
FSTMGRMVDEERTNSGTLKALGYGNADVMLKFTVYGFAASTLGTCIGVLAGHTLLPLIVA
HAYSAGFTMPDIMLKFHPWITMAAFALAWISAVVPSWLAASKELREKPASLLLPKPPAKG
SKILLEHFPPLWNRLNFTHKVTARNIFRYKTRMFMTIFGVCGAVFLLTAGLAVQSSIGQI
GNRQFEELIHYDLIVAEESDTNSAQREEIATTLKGKTVQSSTAVRYEELSKTAGKENDKQ
SITLLAIDDAYNFNEYLTLRDRKTHQPQILVNNGAVISERLAEMLNVSVGDTFTVNDENG
AQRTIKVAGISEMYIGHFIFMNAQCYEHVFGDQYSTNAYMVGLKDHSNANTERQGAKFMK
LAAVRGVVQNTTQKNMVSTIVGSLNQIMEVLILVAVLLAVVILYDLTNLNVSERIRELST
IKVLGFHTSETTMYIYRETILLSLLGILAGYGFGEWLHRYIITEVPPDEVMFDLAISWIA
LAAPAIVVAVVLAVLGWIVYRQLETVDMLEALKSVE
Download sequence
Identical sequences A1A1G8
367928.BAD_0770 gi|119025788|ref|YP_909633.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]