SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|119026096|ref|YP_909941.1| from Bifidobacterium adolescentis ATCC 15703

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119026096|ref|YP_909941.1|
Domain Number 1 Region: 5-122
Classification Level Classification E-value
Superfamily Thiamin pyrophosphokinase, catalytic domain 9.02e-23
Family Thiamin pyrophosphokinase, catalytic domain 0.006
Further Details:      
 
Domain Number 2 Region: 138-209
Classification Level Classification E-value
Superfamily Thiamin pyrophosphokinase, substrate-binding domain 0.0000222
Family Thiamin pyrophosphokinase, substrate-binding domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|119026096|ref|YP_909941.1|
Sequence length 248
Comment hypothetical protein BAD_1078 [Bifidobacterium adolescentis ATCC 15703]
Sequence
MDFHDARTCVIFGAGDYYDETPAIPDDAFVVAADGGLDHARAFGIDADFVVGDFDSITGD
RPTQNDRTIALPSEKDDPDLLSALKIGWLRGARTFHIYGALGGRIDHTISNIQLMALLAD
RGATGYLHGDGSIVTAICDGALDFPADDAVAGRMVSVFSHSDISTGVSETGLKYELHHAD
MSSTRVNGLSNEFLAGRPSRITVEHGTLIVTFPIEAPLPHVARWHGFSGDLGALDTDVSS
ALVEPSGR
Download sequence
Identical sequences A0A1V8QBH3 A1A2C6
WP_011743428.1.24652 WP_011743428.1.36503 WP_011743428.1.41253 WP_011743428.1.51786 WP_011743428.1.55335 WP_011743428.1.64668 WP_011743428.1.90122 WP_011743428.1.92700 367928.BAD_1078 gi|119026096|ref|YP_909941.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]