SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|150401943|ref|YP_001329237.1| from Methanococcus maripaludis C7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150401943|ref|YP_001329237.1|
Domain Number 1 Region: 83-221
Classification Level Classification E-value
Superfamily L domain-like 0.0000198
Family Ngr ectodomain-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|150401943|ref|YP_001329237.1|
Sequence length 293
Comment hypothetical protein MmarC7_0013 [Methanococcus maripaludis C7]
Sequence
MDKFGINKVENKICNVIGDFGFKKKENGYEIDRYSGNSKEIIINEKYNEIPIIGIGDEIF
HYSGLMSVTIPESVTYIGDRAFHANNLSEISIPKLVSHIGDMAFSNNELTSLIIPESVKA
IGNNAFKNNKLTQVVIPESVTYIGEFAFHKNQIKGIIIPDSITRIYNDSFSNNLLTGVVI
PDSVTHIMWNAFKNNKLTGIIIPDSVTCLGEECFSDNNLKYVILGNSVTDIGNSAFKNNP
DLKICCKKGSYAEKYSKKNNIPCLYLDTDETSSSLVKKPDVNIPEKTRLNHIS
Download sequence
Identical sequences A6VF60
426368.MmarC7_0013 gi|150401943|ref|YP_001329237.1| WP_011976423.1.31125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]