SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150402108|ref|YP_001329402.1| from Methanococcus maripaludis C7

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|150402108|ref|YP_001329402.1|
Domain Number - Region: 277-344
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000284
Family MarR-like transcriptional regulators 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|150402108|ref|YP_001329402.1|
Sequence length 348
Comment hypothetical protein MmarC7_0181 [Methanococcus maripaludis C7]
Sequence
MAKSKLVATFNGKGIIATPYTLRDPFTKWRNLKIELYEDSLEFIFENKKIEASFDQIDDI
GFELPRKALEIAKNNLDDISIYGSFRLSPPDEDKFSIGYAPEASIYGEPTINAFLKKLFQ
QLLNKKEMKLQYARIVGGSVDVDAQWEDGYLVFAKKPVKRGVSVIEEMVLAAAVTSGDKP
KVYDLFNNIESISLEKKKIDDEDKDVLEIKQLRGGETVNSYIHIPSTKMLYVLRYISKLT
KYHNTVKSLLPKSEDDLDSEIAVESWSGDKLKNEVDQLTPEEQEVLAAIYTGITSLELPG
MMGMDIDEVERILEKLIDRGFLDLIRIRKEADLTEKGRAVTNFIITNF
Download sequence
Identical sequences A6VFM5
426368.MmarC7_0181 WP_011976588.1.31125 gi|150402108|ref|YP_001329402.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]