SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150402233|ref|YP_001329527.1| from Methanococcus maripaludis C7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150402233|ref|YP_001329527.1|
Domain Number 1 Region: 5-78
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000714
Family CAP C-terminal domain-like 0.079
Further Details:      
 
Weak hits

Sequence:  gi|150402233|ref|YP_001329527.1|
Domain Number - Region: 105-167
Classification Level Classification E-value
Superfamily Alpha subunit of glutamate synthase, C-terminal domain 0.00196
Family Alpha subunit of glutamate synthase, C-terminal domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|150402233|ref|YP_001329527.1|
Sequence length 269
Comment regulatory protein Crp [Methanococcus maripaludis C7]
Sequence
MKKRNITEFQILSEVVRRQPHIKQKEIADILGITVQGVSEHMRNLIKDEHIRNKGRGEYL
ITEKGMAFLKTWISDFKNYLNDVNQNLYRYKDVWPAIASENIAPGDTVGVYMKKGVIYVS
KNIESDATAKVFLGGNSGDDVAIHEIHGHIEVHNGKVIVLKIPSEVMGGSRNVDYEIVRN
TLEEHPDAVIATAGTVGTVIVNKLEIHPDIRFAVSEGIVSACNRGCDVIAIITGKMAEKI
IKTIDKNKISYTLLNASKMTDSDENPMFL
Download sequence
Identical sequences A6VG00
426368.MmarC7_0306 WP_011976712.1.31125 gi|150402233|ref|YP_001329527.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]