SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|150402245|ref|YP_001329539.1| from Methanococcus maripaludis C7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150402245|ref|YP_001329539.1|
Domain Number 1 Region: 13-67
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000796
Family Transcriptional regulator IclR, N-terminal domain 0.059
Further Details:      
 
Domain Number 2 Region: 79-139
Classification Level Classification E-value
Superfamily ACT-like 0.0000000108
Family AF1403 N-terminal domain-like 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150402245|ref|YP_001329539.1|
Sequence length 144
Comment BadM/Rrf2 family transcriptional regulator [Methanococcus maripaludis C7]
Sequence
MKIDGLTEKILTLLEKYSTTREIAAELETHPKNIDRYIRVLRDLGFIETKKGKTGGVFLT
NEGRYVLKKKNINLITIKVQVVAEDKIGLLASISSKISEINGNILSTTLEKEGNKVRVWL
VIENLEFNDLKDNLKEITDKVVLL
Download sequence
Identical sequences A6VG12
gi|150402245|ref|YP_001329539.1| WP_011976724.1.31125 426368.MmarC7_0318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]