SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|150402278|ref|YP_001329572.1| from Methanococcus maripaludis C7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150402278|ref|YP_001329572.1|
Domain Number 1 Region: 9-106
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000186
Family TrmB-like 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150402278|ref|YP_001329572.1|
Sequence length 135
Comment transcriptional regulator TrmB [Methanococcus maripaludis C7]
Sequence
MNSIENVDRKLIENLANLMSSEVRAKIYIYLRKYNKSTVDEIADGTGIYPSTVRESILDM
YNTGYVSREKMDKEGLGKKPYLYTAAAPSEIVRKISKSIQEKLNDLIMVDKRLDAKELKI
PFVPVKIVVDEKYKD
Download sequence
Identical sequences A6VG45
426368.MmarC7_0352 WP_011976756.1.31125 gi|150402278|ref|YP_001329572.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]