SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150402314|ref|YP_001329608.1| from Methanococcus maripaludis C7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150402314|ref|YP_001329608.1|
Domain Number 1 Region: 1-61
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.31e-17
Family Lrp/AsnC-like transcriptional regulator N-terminal domain 0.0025
Further Details:      
 
Domain Number 2 Region: 61-140
Classification Level Classification E-value
Superfamily Dimeric alpha+beta barrel 0.0000000000000188
Family Lrp/AsnC-like transcriptional regulator C-terminal domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|150402314|ref|YP_001329608.1|
Sequence length 140
Comment AsnC family transcriptional regulator [Methanococcus maripaludis C7]
Sequence
MDEKDMKILDFLILDGRKPFTEIAKELKTSESSVRKRVKKMEEEGVIKGYSVMVDTPKMG
YNVVAQTGFDTNPEDFLAVAQELCKFEEVKKVFTSTGDHMIMTEIWAKDGKELSEIIFNK
IGKIKGIKKVCPAIILEQLK
Download sequence
Identical sequences A6VG81
gi|150402314|ref|YP_001329608.1| WP_011976792.1.31125 426368.MmarC7_0388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]