SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150402348|ref|YP_001329642.1| from Methanococcus maripaludis C7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150402348|ref|YP_001329642.1|
Domain Number 1 Region: 159-340
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 4.14e-21
Family CAC2371-like 0.097
Further Details:      
 
Domain Number 2 Region: 25-100
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000409
Family TrmB-like 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150402348|ref|YP_001329642.1|
Sequence length 361
Comment hypothetical protein MmarC7_0422 [Methanococcus maripaludis C7]
Sequence
MTTEKYQNSFPLPDESPEKIDKIMSDAYFGAQKFYLLKTALELKIFDYLSDPKTSEELSS
ILDLDPVLTELMLKSLYELGIISIASKNGETHYINTNGSDNYLKTDSKYSKAPSISASFN
SMDRWVKLSEIMGSSKSEIMENVFFPEIIKRMANDAKCWELQKTVEYVSKFSEFKSAKKL
LDIAGGHGLYGISLGMLNENLDAFVFDLPEVTVETKKFIEKYNAKNVDTVQGNFFTDEFG
ENYDVVFSSYNPGGKNPKVAEKVYRALNLGGIFVTKQAFPKLSSQSTSDNLNNMEWNFSS
FNATGKGLVRYTFDTDLTFEEYVSYLEELGFEILETKPVYELIEFSEEMFPNNIIVAKKI
K
Download sequence
Identical sequences A6VGB5
WP_011976824.1.31125 gi|150402348|ref|YP_001329642.1| 426368.MmarC7_0422

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]