SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150402349|ref|YP_001329643.1| from Methanococcus maripaludis C7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150402349|ref|YP_001329643.1|
Domain Number 1 Region: 152-337
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 0.00000000000000229
Family Protein-L-isoaspartyl O-methyltransferase 0.075
Further Details:      
 
Domain Number 2 Region: 24-101
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000227
Family TrmB-like 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150402349|ref|YP_001329643.1|
Sequence length 360
Comment hypothetical protein MmarC7_0423 [Methanococcus maripaludis C7]
Sequence
MTTKNYQNSFPLPDESPEKIDKIMSETYFGAQKFYLLTTALELKIFDYLTEAKTSEELSS
ILDLDPVLTELMLKSLYELGIISVASKNGKTHYINTTASDTYLKMDSTYSKSISISASFK
SIGMWVNLSEMMKSSKQNVVENVFFPELIKIMANDCKVWELQKTVEYIYKFPEFKTAKKL
LDIAGGHGLYAISLGMLNENLDGFVFDIPPVTFETKKFIEKYNAKNVNTIPGNLFTDNIG
ENYDVVFNSYNPGGKNPKVAEKIYNSLNMGGLYIIKQIYQKETHDVEDTLNNMEWNFNSF
NGNGKGTLRYTFEQDLDFEGYLSHLETLGFEILETKSVSEISDFDEELTPSIITVAKKIK
Download sequence
Identical sequences A6VGB6
426368.MmarC7_0423 gi|150402349|ref|YP_001329643.1| WP_011976825.1.31125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]