SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150402611|ref|YP_001329905.1| from Methanococcus maripaludis C7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150402611|ref|YP_001329905.1|
Domain Number 1 Region: 3-91
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 9.33e-28
Family ArsR-like transcriptional regulators 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|150402611|ref|YP_001329905.1|
Sequence length 95
Comment regulatory protein ArsR [Methanococcus maripaludis C7]
Sequence
MAMEEYKYEYMAEVFKAFADPTRLMILELLSENESMCVCKIIDELKKPQPTISHHLNILK
KSGIIKARKEGTWNHYYIVNPKVREMISIMGGIVD
Download sequence
Identical sequences A4FW82 A6VH28
gi|134045182|ref|YP_001096668.1| WP_011867913.1.31125 WP_011867913.1.72418 gi|150402611|ref|YP_001329905.1| 402880.MmarC5_0136 426368.MmarC7_0687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]