SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150402613|ref|YP_001329907.1| from Methanococcus maripaludis C7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150402613|ref|YP_001329907.1|
Domain Number 1 Region: 7-205,275-299
Classification Level Classification E-value
Superfamily Creatinase/aminopeptidase 1.44e-61
Family Creatinase/aminopeptidase 0.00000235
Further Details:      
 
Domain Number 2 Region: 202-275
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000000083
Family Methionine aminopeptidase, insert domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150402613|ref|YP_001329907.1|
Sequence length 300
Comment methionine aminopeptidase [Methanococcus maripaludis C7]
Sequence
MVDKMDNSEEYNKIIEAGKIASQVRGEALKLVKPGAKLYDVAEFVENRIIELGAGVGFPC
NISLNDIAAHYSPSHGDETVFSEEDVVKLDLGAHVDGFISDTAVTIDLSGKYSDLKKASE
DALNTVIKEIVPGINVGEMGKIIQEVIESYGYRPISNLSGHVMHQYSLHSGVSIPNVYEN
TKDTIDVGDLVAIEPFATDGFGQVTDGKDVYIFKYLRSRPVRLPAARNLLRNVEQNHAYL
PFSERDMAKIDAHYKAGLKALMMAGVLYGYPTLVEREHGIVSQSEHTVLITENGVEVTTK
Download sequence
Identical sequences A6VH30
WP_011977077.1.31125 426368.MmarC7_0689 gi|150402613|ref|YP_001329907.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]