SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|150402807|ref|YP_001330101.1| from Methanococcus maripaludis C7

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|150402807|ref|YP_001330101.1|
Domain Number - Region: 25-113
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00166
Family ArsR-like transcriptional regulators 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150402807|ref|YP_001330101.1|
Sequence length 340
Comment hypothetical protein MmarC7_0883 [Methanococcus maripaludis C7]
Sequence
MIIETLLILFLFSLFSKGAKNKKEALEIINKDLNALTILSYFKENTKNNVVMSASPGRIS
EVLNVDLTELEPSFDVLSEKKLVKKIHTGYKNCPIKYEITPFGRTVISEHFRKEKLKNNP
NYQKPANRRPKNNGALFDKINENISQDKKEEKPKEIKPKAEEPKKNQNLIKNKFEQDVPI
NFYSKTNNDENLSFEIGEAFENFVAEQLFPDHHFVLTHMTPNFAMNSKRYCESSLKPDLG
FRDKKTGKEFYVECKFRGGLTEDGKYSWTKDKDQANRYRDIQKDENKQVFVAMGLGGMSN
NPRNIFLVPLDEIKYLELYPSVLRNWEVYNVYDIFKIVNS
Download sequence
Identical sequences A6VHM4
gi|150402807|ref|YP_001330101.1| 426368.MmarC7_0883 WP_011977266.1.31125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]