SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|150402853|ref|YP_001330147.1| from Methanococcus maripaludis C7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150402853|ref|YP_001330147.1|
Domain Number 1 Region: 150-278
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 0.00000000000194
Family Hypothetical protein MJ0882 0.025
Further Details:      
 
Domain Number 2 Region: 41-100
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000047
Family CAP C-terminal domain-like 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150402853|ref|YP_001330147.1|
Sequence length 390
Comment hypothetical protein MmarC7_0929 [Methanococcus maripaludis C7]
Sequence
MKIIGSMGKKTENLKIDAKKSFLKRVAKNVKVSEGERAVEDILRCIYRKQPISTKKIGQY
VKLPLPIVSKVRSILERESLLKRDDKGALFSKEGVDFVERELGLKLKSDLKCPVCNGRNI
VFDEKFEKILKKQKNYAKLRPQVNTMIDQSFATPETATARAAIMADRGDLEGKRVLFVGD
DDLASISTAMTGLCSEVVVLDIDDRLLKLISEVSKKENLNIKTVKWDFKNELPSEFVNKF
DTIFTDPPYTLNGAVLFMSRGIEALGDNGILYLAFSHKPVEEYIELQKSINNMNFLIYEL
IPGFNFYEGTEIIGNTTFLARLVGKNLKKIEVNSEKIYTGELKPTLRYYQCMNCKKIHEV
GDKIKRIEELTCECGGKKFSMVKRSKVKQN
Download sequence
Identical sequences A6VHS0
WP_011977312.1.31125 gi|150402853|ref|YP_001330147.1| 426368.MmarC7_0929

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]