SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|150402911|ref|YP_001330205.1| from Methanococcus maripaludis C7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150402911|ref|YP_001330205.1|
Domain Number 1 Region: 91-293
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 5.9e-35
Family Phosphate binding protein-like 0.0016
Further Details:      
 
Domain Number 2 Region: 5-113
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 5.72e-21
Family LysR-like transcriptional regulators 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|150402911|ref|YP_001330205.1|
Sequence length 296
Comment LysR family transcriptional regulator [Methanococcus maripaludis C7]
Sequence
MDPKISYFQTFLFAAKTKSFSKAAKKLGVTQGTVSNHISVLEKFFDAQLFLRTPEGVDLT
TEGNILYENAEKLLENISNAKQQMRILHEHPEGVIRIAASTTPGEHLLPSIIKDYTKVFR
DVSFQIQITDSEKCFKLLEDRTVDIIAVGNIYDGSYESEVIGKDRLVLIVPPEHQLAKKG
VAKFSDLLKEDYIDREVGSGTREIFVDALQDKGYSMMDLHTIMSLGSNSSIITAVSEGYG
ISIISEIPAKKAADAGQLQIVPIEDLDLTRYMYLVKGKKPRNPSAIKSFWDFVSGK
Download sequence
Identical sequences A6VHX8
WP_011977368.1.31125 gi|150402911|ref|YP_001330205.1| 426368.MmarC7_0987

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]