SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150402917|ref|YP_001330211.1| from Methanococcus maripaludis C7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150402917|ref|YP_001330211.1|
Domain Number 1 Region: 16-99
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000908
Family Archaeal DNA-binding protein 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150402917|ref|YP_001330211.1|
Sequence length 105
Comment hypothetical protein MmarC7_0993 [Methanococcus maripaludis C7]
Sequence
MMFINPTIIRSLNKSKLRKKIVYFLYDIHPHGTYLSELSRRVKSDPSNVLGCLKGMGNRY
NGSSSLIELGLVNCDGKEGMKIYQMTNYGKTVVEYLKDYDSADNW
Download sequence
Identical sequences A6VHY4 A9A8U5
gi|159905338|ref|YP_001549000.1| WP_011977373.1.31125 WP_011977373.1.31524 gi|150402917|ref|YP_001330211.1| 426368.MmarC7_0993 444158.MmarC6_0953

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]