SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150402939|ref|YP_001330233.1| from Methanococcus maripaludis C7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150402939|ref|YP_001330233.1|
Domain Number 1 Region: 18-98
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000263
Family MarR-like transcriptional regulators 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150402939|ref|YP_001330233.1|
Sequence length 280
Comment LysR family transcriptional regulator [Methanococcus maripaludis C7]
Sequence
MNKLSESDLSVTLNINYRGKHVTKTQVEILKLVSETKSQNKVAEILGIPPSTVNIQIKRL
ENKLDLKLIHSSPAGTMLSDDAERIVSFYNAYLERTSKEKFIACGFISGEVGRLLFDDVL
VSSFSNVLKLYKSNLTSIVGIDDPYWSYRLGDPVPVAFDHFVMVSKDEFDHKNLLGVNYS
AHRIVWKTLKNEKIDFKVAKVVKNPFYAIDLLEEGYSMFLNTCLLRYVKKDYLIETPEYY
DKTRHTINFILNNSILENEFEELLYKKQKEIKSAGFEPIL
Download sequence
Identical sequences A6VI06
WP_011977395.1.31125 gi|150402939|ref|YP_001330233.1| 426368.MmarC7_1015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]