SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150402952|ref|YP_001330246.1| from Methanococcus maripaludis C7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150402952|ref|YP_001330246.1|
Domain Number 1 Region: 259-317
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000681
Family Lrp/AsnC-like transcriptional regulator N-terminal domain 0.088
Further Details:      
 
Weak hits

Sequence:  gi|150402952|ref|YP_001330246.1|
Domain Number - Region: 60-108
Classification Level Classification E-value
Superfamily Surp module (SWAP domain) 0.0445
Family Surp module (SWAP domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|150402952|ref|YP_001330246.1|
Sequence length 357
Comment regulatory protein ArsR [Methanococcus maripaludis C7]
Sequence
MEIIYNKPEIYATNDIWIQPVSRSSVLSSNVVGNCKIIHNIPVLRVLGSPSLKRTVLNIL
HVLKDKMTFFKKNCESEGMDNIFKYLNDIYFDKSVNNYYRAKKAWYRVIGDLFEDVNNWN
FKKVMGKLITILKVLNPVLVFDLHDVSKWNHLKTFQRFIQFLKNEGISLVLRCPFEAYSF
LKDNFEDHKTNSIAAVIYYTKKKGYLISEKVSKELLKLSSGNLKVIDLILANSKRDLKNL
RDLKLSWKRILPEIVPNKYKNIVQKIVLLKKFNIKEISSILEYSQSTVYNYLNELAELNI
VKKRKLNKNILFKLNINKEIVNNIIKSDFDFKNIFFEINNSNLKNRTEMFNGFLIFG
Download sequence
Identical sequences A6VI19
WP_011977408.1.31125 426368.MmarC7_1028 gi|150402952|ref|YP_001330246.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]